(WEBTOON) Đọc truyện tranh trực tuyến.

  • 2022-01-07Ngày thu
  • 2022-02-15Đã cập nhật
(WEBTOON) Đọc truyện tranh trực tuyến.
  • Địa chỉ trang web:www.webtoons.com
  • IP máy chủ:203.104.167.129
  • Mô tả trang web:WEBTOON là nhà hàng ngàn câu chuyện trong các loại 23: lãng mạn, hài hước, hành động, ảo tưởng và kinh dị. Đọc truyện tranh, tạp chí mạng, xoài, và man trên mạng hoặc tải ứng dụng WEBTOOON.

tên miền:www.webtoons.comĐịnh giá

Về 5000~500000

tên miền:www.webtoons.comlưu lượng

416

tên miền:www.webtoons.comTốt hay xấu

Làm ăn phát đạt. Danh vọng và tài sản Ji

trang mạng:(WEBTOON) Đọc truyện tranh trực tuyến.Trọng lượng

4

trang mạng:(WEBTOON) Đọc truyện tranh trực tuyến.IP

203.104.167.129

trang mạng:(WEBTOON) Đọc truyện tranh trực tuyến.Nội dung

WEBTOON-ReadComics,Manga&Manhwa window.__headerState__={ domain:"", phase:"release", nclkLangueCode:"en_en", langueCode:"en", cssCode:"en", cssCodePrefix:"", gaTrackingId:"UA--1", ga4TrackingId:"G-ZTE4EZ7DVX", contentLangue:"ENGLISH", contentLangueCode:'en', gakSerName:"gak.webtoons.com", gakPlatformName:"WEB_PC", serviceZone:'GLOBAL', facebookAdId:"", nclickServer:"cc.loginfra.com", lcsServer:'lcs.loginfra.com', browserType:"CHROME", gaPeName:"", googleAdsState:{ gadWebtoonReadEvent:"", title:"", titleNo:"", episodeNo:"", gadConversion:{ "th":[{ //GAD태국광고계정1 conversionId:"AW-9",//AW-CONVERSION_ID:GoogleAds계정에고유한전환ID conversionLabel:"yhf1CLXkr-0CEKGz_uoC"//AW-CONVERSION_LABEL:각전환액션에고유하게부여되는전환라벨 },{ //GAD태국광고계정2 conversionId:"AW-6", conversionLabel:"GzVDCNuRsO0CEKji6ekC" }] //언어가추가되면배열로넣음 } }, afPbaKey:"fe-9461-4b38-a417-7611db3b631e", } letccsrv=window.ccsrv=window.__headerState__.nclickServer; letnsc=window.nsc="webtoons.all"; letnclk_evt=window.nclk_evt=3; letlcs_SerName=window.lcs_SerName=window.__headerState__.lcsServer; letsNclkLangueCode=window.sNclkLangueCode=window.__headerState__.nclkLangueCode; skipcontent WEBTOON WEBTOONSHOP Creators101 Publish LogIn ClosetheLoginwindow Search SearchbySeriesTitleorCreator Search Delete | Close MENU ORIGINALS GENRES POPULAR CANVAS . . . . . . . . . . . . . . MON TUE WED THU FRI SAT SUN MORE MONWEBTOONS CursedPrincessClub MeetGwendolyn–livingproofthatprincessesdon’talwaysheitall.See,althoughshelivesinacastleandherfatheristheKing,Gwendolynisn’tlikeamovieprincess,orevenafairly-taleprincess.She’sgotabigheart,butisn’tparticularlyattractiveanddoesn’theaDisney-qualitysingingvoice.Butonenight,sheaccidentallystumblesuponthetwistedworldoftheCursedPrincessClub,andherlifewillneverbethesame.Hexedandcastout,theladiesoftheclubarejustthepeopleGwendolynneedstoshowherthatjustbecauseshedoesn’t“fitthemold”doesnotmeanshe’sanylessofaprincess. like23.5M Comedy CursedPrincessClub LambCat MeetGwendolyn–livingproofthatprincessesdon’talwaysheitall.See,althoughshelivesinacastleandherfatheristheKing,Gwendolynisn’tlikeamovieprincess,orevenafairly-taleprincess.She’sgotabigheart,butisn’tparticularlyattractiveanddoesn’theaDisney-qualitysingingvoice.Butonenight,sheaccidentallystumblesuponthetwistedworldoftheCursedPrincessClub,andherlifewillneverbethesame.Hexedandcastout,theladiesoftheclubarejustthepeopleGwendolynneedstoshowherthatjustbecauseshedoesn’t“fitthemold”doesnotmeanshe’sanylessofaprincess. I’mtheQueeninThisLife like5.5M Fantasy I’mtheQueeninThisLife Themis/Omin TheEtruscanKingdomisstainedwithbloodwhentheking’sillegitimatesonCesareconspireswithhisfiancéeAriadnetousurpthethronefromhishalf-brotherAlfonso.DespiteAriadne’sdevotiontothenewking,herfaithisshatteredwhensheisbetrayedbyhimandeventuallymurderedbyherownsister,whowishestobequeen.Tohersurprise,Ariadnefindsherselfsentbackintimetoher17-year-oldself.Asshenigatestheperilsandopportunitiesofpalaceintrigue,Ariadnemustmakethemostofherguileandgrittoensurethathertricfuturedoesnotrepeatitself. ToTheStarsandBack like9.8M HIATUS Sliceoflife ToTheStarsandBack Peglo Introvertedandgrumpy,20-year-oldKangDaespendsthemajorityofhistimealone,andheprefersitthisway.Oneday,hegetsaveryfriendlyandbubblyneighbornamedBoSeon.Suddenly,hislifetakesaverydifferentturn. TheRebornYoungLordisanAssassin like11,205 Fantasy TheRebornYoungLordisanAssassin SWINGBAT/CoffeeLime CyanVert,illegitimatesonoftheDukeandtheempire'sgreatestassassin,isbetrayedbytherighteousbrotherwhoseshadowhe'salwayslivedin.Butjustbeforethefatalblowstrikeshisthroat,Cyanawakestofindhe'sjustaboyain.Theyounglordhasbeenreborn,andthistime,he'snotgoingtoliveinanyone'sshadow! MorganaandOz like7.1M Fantasy MorganaandOz Miyuli Whathappenswhenastrugglingwitchmeetsanangstyvampire?Eitherloveorwar.Morganabelongstoalonglineofwitches,andOztotherivalvampireclan.Afterachanceencounter…andmaybeafewstrayspells…thesetwoneedtofindawaytoworktogether,orriskall-outwarbetweencovenandclan. SubZero like25.8M Romance SubZero Junepurrr Whatwouldyousacrificetoseyourfamily?Howfarwouldyougotoprotectyourpeople?ForClove,thelastprincessofanear-extinctDronclan,theansweristheunthinkable:MARRYyourgreatestswornenemyinanefforttobringpeacetoyourland. TenWaystoGetDumpedbyaTyrant like723,555 Fantasy TenWaystoGetDumpedbyaTyrant danmyeong/mapzzil ScarlettArmanisnoordinarylady,notjustbecauseshe’sengedtotheemperor.Newlyreincarnatedasacharacterinafantasynovel,Scarlettknowssheissupposedtodieahorribledeathatthehandsofherfiancé,CharleonKalior.Determinedtoescapeherfate,ScarlettdecidestomakeCharleonbreakofftheengement...Butwhydoeshekeepwantingtospendtimewithher?! TheLazyLordMasterstheSword like3.8M Fantasy TheLazyLordMasterstheSword Dodomoon/doip Afterwitnessingtheshockingdeathofhismother,youngAirenFarreirausessleeptoescapehispainfulreality,earninghimthenickname,“thelazylord”.Yet,inspiteofothers’jeersandwhispers,Airenhasnointentionofchanginghisways.Butwhenheawakensonedayfromadreamaboutamysteriousswordsman,hislife’strajectorytakesacompleteturn... FLOAT like762,470 Romance FLOAT CjJoaquin/KateMarchant Amidstthechaosofherparents’bitterdivorce,AlaskanteenerWerlyLyonstradesinhertextbooksandparkaforasummerofsuntansandshort-shortswithherauntinFlorida.Afishoutofwaterevenbackinthesnow,Werlyisdeterminedtobeeverythingsheisn’tbackhome:cool,fun,daresheevensaypartofagroup?There’sjustoneproblem.Shedoesn’tknowhowtoswim.EnterBlake—thesuper-tan,super-hot,super-arrogantboynextdoorwhoseemstohateherguts.Whenhediscovershersecret,Werlyispositivethatherperfectsummerisperfectlyover.ButthenBlakedoestheunthinkable.Heofferstoteachher. DownToEarth like22.4M UP Romance DownToEarth PookieSenpai Kadeliveshiserelifealoneandundisturbed...untilacutealiengirlcrashesintohisbackyard!Byopeninguphishome,willthisotherworldlygirlinadvertentlyopenuphisheart? TheMafiaNanny like1.1M UP Romance TheMafiaNanny sh00/VioletMatter BeinganEliteNannyissimple:protectthecharge,obeytheprinciple,anddon’tgetemotionallyattached.EasiersaidthandonewhenDina’sfirstclientisadangerouslycompellingVenetianunderbosswho’sdeterminedtogetunderherskin.Whathewantsfromher,shecan’timine,butGabrielAngelinidrsherbackintotheglitteringworldoforganizedcrimeshethoughtshe’dleftbehindforever.Shemightgetanswersaboutherpastifshedigsdeepenough,butcansheprotectMikeyfromhisfather’sambitionsandkeepherheartfromgettingtangledupintheirtreacherousweb? NotYourTypicalReincarnationStory like1.9M UP Romance NotYourTypicalReincarnationStory LemonFrog/A-jin Notallvillainsareevil.WhenSunaChoireincarnatesasEdithRigelhof,thevillainfromherforitenovel,sheisdeterminedtochangeEdith’slifearoundandtreatseveryonewithkindness.AlthoughshemarriesthehandsomeKillianRudwick,heismadlyinlovewiththeoriginalprotonistofthebookandmistrustsEdithbecausesheisfromarivalfamily.Willhermarriesurvivethewhirlwindoffamilyfeuds,lovetriangles,andmore?WillEdithfindherhappyending? Boyfriends. like24.2M HIATUS Sliceoflife Boyfriends. refrainbow Acomicaboutgettingyourselfaboyfriend...ormultipleboyfriends!Fourcollegestudentsbeginapolyamorousrelationshipandnigatetheadventurethatistheirdatinglife! TheTyrantWantstoBeGood like3.4M UP Fantasy TheTyrantWantstoBeGood Ramguel/KAKON NothingwaseverhandedtoDorotheaMillanaire.Noattention,nolove,nopower.Soshedecidedtotakethemforherself…withhersword!Sheacceptsherfatewhensheisexecutedforbeingabloodthirstytyrant,onlytowakeup...asachild?!Thisishersecondchance.Shemustnotrepeathistory.Shemustbegood. OmniscientReader Dokjawasanereofficeworkerwhosesoleinterestwasreadinghisforitewebnovel'ThreeWaystoSurvivetheApocalypse.'Butwhenthenovelsuddenlybecomesreality,heistheonlypersonwhoknowshowtheworldwillend.Armedwiththisrealization,Dokjauseshisunderstandingtochangethecourseofthestory,andtheworld,asheknowsit. like27.9M UP Action OmniscientReader singNsong/UMI Dokjawasanereofficeworkerwhosesoleinterestwasreadinghisforitewebnovel'ThreeWaystoSurvivetheApocalypse.'Butwhenthenovelsuddenlybecomesreality,heistheonlypersonwhoknowshowtheworldwillend.Armedwiththisrealization,Dokjauseshisunderstandingtochangethecourseofthestory,andtheworld,asheknowsit. Homesick like7.9M HIATUS Thriller Homesick Ms.Freaky Raynewokeupwithnomemoriesoftheapocalypse.Samaelisjust...adelinquent,whohappenedtofindRayneatarooftop.Theybothendedupmakingadealinordertosurviveinaworldwherecannibalisticmonstersroam. Eleceed like26.9M UP Action Eleceed JehoSon/ZHENA Jiwooisakind-heartedyoungmanwhoharnessesthelightningquickreflexesofacattosecretlymaketheworldabetterplace–onesedlittlechildorfosterpetatatime.Kaydenisasecretentontherun,whofindshimselfstuckinthebodyofa…um…decidedlyfatoldfluffycat.Together,armedwithJiwoo’ssuperpowersandKayden’suber-smarts,they’reouttofightthoseforceswhowouldletevilrulethisworld.Thatis,iftheycanstandeachotherlongenoughtogetthejobdone. MuseonFame like2.5M UP Drama MuseonFame SOOJIN “I’manunknownactresswhocleanshousesasasidegig.Ironically,mynamemeansfame.”StrugglingactressMyeongstumblesuponaphotoexhibitionfilledwithphotosofheryoungerself,whenshewasfilledwithhope.Canshebecomeastarasthismysteriousphotographer’smuse? TheDronKing’sBride Tenyearso,ayounggirlsedthelifeofadron.Littledidtheyknowthattheywouldbebroughttogetherainbythevicissitudesoffate,whenLucina’sfamilyestateisinvadedbythefearsomeTayarnationledbyKingHakan.AfterLucina’sselfishstepmotheroffersherupasabridetoHakaninexchangefortheirlives,LucinarealizesthatsheisnowfatedtojourneytothearidkingdomofTayarandmarryitsseeminglybrutishking.Willfateleadtheunlikelypairtoruinorromance? like2.4M Romance TheDronKing’sBride SOYMEDIA/KangheeJamae Tenyearso,ayounggirlsedthelifeofadron.Littledidtheyknowthattheywouldbebroughttogetherainbythevicissitudesoffate,whenLucina’sfamilyestateisinvadedbythefearsomeTayarnationledbyKingHakan.AfterLucina’sselfishstepmotheroffersherupasabridetoHakaninexchangefortheirlives,LucinarealizesthatsheisnowfatedtojourneytothearidkingdomofTayarandmarryitsseeminglybrutishking.Willfateleadtheunlikelypairtoruinorromance? SchoolBusGreyard like6.1M Thriller SchoolBusGreyard Red Ashlynisalonerinhighschoolwithnofriends.Butwhenafatefulvisittoahauntedhousecausesherandherclassmatestoseemonstersatnight,she'llbeforcedtoforgebondstosurvive. TeeneMercenary like12.6M Action TeeneMercenary YC/Rakyeon Attheeofeight,IjinYulosthisparentsinaplanecrashandbecamestrandedinaforeignland,forcedtobecomeachildmercenaryinordertostayalive.HereturnshometenyearslatertobereunitedwithhisfamilyinKorea,wherefoodandshelterareplentyandeverythingseemspeaceful.ButIjinwillsoonlearnthatlifeasateenerisawholeotherfeatofsurvival.Withonlyoneyearofhighschoolleft,Ijinmustmasternewtacticstomaneuverhiswayaroundtheschoolhousebattleground.Canhesurviveayearofhighschool?Orrather,willtheschoolbeabletosurvivehim? HelloBaby like3.2M (WEBTOON) Đọc truyện tranh trực tuyến. Romance HelloBaby Enjelicious Gwen,apprehensiveanddisheartened,spendsaone-nightaffairwithaplayfulstranger,Arthur.Afternearly2yearspass,GwenandArthurcrosspathsain-thistimefightingovertheirchild'scustody.Isitpossibletosettlethisbattleamicably,orwillGwenfindherselfdesolateonceain? JungleJuice like8M Action JungleJuice HyeongEun/JUDER SuchanJangisanextraordinarycollegestudentatthetopofthesocialfoodchain.Butunderneaththeperfectfacade,hehidesapairofinsectwingsthatsuddenlygrewwhenheusedamysteriousbugspraycalled"JungleJuice.”Suchan'slifecrumbleswhenhebareshiswingstotheworldtosesomeone'slife.Whenallhopeseemslost,Suchanstumblesuponahiddenworldofinsecthumanswhereeveryoneisacceptedforwhattheyare.Butthelawofthejunglegovernsthissecretsocietyandallmustfendforthemselvesinordertosurvive. TheD!ckheads like576,922 Romance TheD!ckheads GummyBunni Afterbeingbulliedatheroldschool,ElianadecidestomovetothesmalltownofOaksdaletostartfresh.ThereshebefriendsFootballCaptainandmostpopularboyatschool,Levi,aswellaslone-wolfandoutcast,Marco.She'sfinallygotthefriendsshealwayswanted,butwhatwillshedowhenshefindsouttheyhateeachother? ClinicofHorrors like7.4M Supernatural ClinicofHorrors Merryweather/PokuriMio Inastrangecity,thereisaclinicthatwilltreatthevictimsofhorrificdiseases.Foraprice. Daybreak like7.7M Sliceoflife Daybreak Moosopp Marcushasacrush,andCogiscompletelyunpreparedforthehijinksthatfollow.Hopefullyintheireffortstogrowcloser,theycanbrighteneachother'sday. IWillLivetheLifeofaVillainess like289,438 Romance IWillLivetheLifeofaVillainess massi/TARU Afterafatalcarcrash,YunaJeongawakensinthebodyofElenaRosaria,acharacterinthenovelshereadinherpreviouslife.Butthere'satwist—Elenaisnoordinarycharacter.She’sanotoriousvillainesswhomeetsagrimend.Now,Yunamustalterherdestinyinachaoticworldandfindherwayinthisnewlife.Cansherewriteherdestinyamidstthesurroundingchaos? unOrdinary like62.9M Superhero unOrdinary uru-chan NobodypaidmuchattentiontoJohn–justanormalteeneratahighschoolwherethesocialelitehappentopossessunthinkablepowersandabilities.ButJohn’sgotasecretpastthatthreatenstobringdowntheschool’swholesocialorder–andmuchmore.Fulfillinghisdestinywon’tbeeasythough,becausetherearebattles,frenemiesanddeadlyconspiraciesaroundeverycorner. EaternalNocturnal Themanofherdreamsdoesexist…toobadshecan’tfallasleep.WhenEveisvisitedonenightbyamysteriousapparition,shefindsthatherchronicinsomniaismiraculouslycured.MeanwhileDae,thedreameater,findshimselfunexpectedlyandunwillinglydrawntoEve.Thiscaneitherbeadreamcometrueortheirworstnightmare. like8.4M Romance EaternalNocturnal instantmiso Themanofherdreamsdoesexist…toobadshecan’tfallasleep.WhenEveisvisitedonenightbyamysteriousapparition,shefindsthatherchronicinsomniaismiraculouslycured.MeanwhileDae,thedreameater,findshimselfunexpectedlyandunwillinglydrawntoEve.Thiscaneitherbeadreamcometrueortheirworstnightmare. IAmtheVillain like2.4M Romance IAmtheVillain Sejji Workinghardissupposedtotakeyoufar-butintotheworldofyourbestfriend'snovel?ForLucy,beingwhiskedintoalifeofballroomsandpicnicsisn'texactlywhatit'scrackeduptobe;atleast,notwheneveryonehasmistakenherforthevillainflgedfordeath.Toescapethisfate,Lucymusttransformfrommodernworkaholictohighsocietyschemerifsheevenhasachanceatreturninghome.Willshemakeit?Orwillthisworldofbeautifuloutfits,strawberrydesserts,anddashinglyhandsomegentlemensealherfate? ToTheStarsandBack like9.8M HIATUS Sliceoflife ToTheStarsandBack Peglo Introvertedandgrumpy,20-year-oldKangDaespendsthemajorityofhistimealone,andheprefersitthisway.Oneday,hegetsaveryfriendlyandbubblyneighbornamedBoSeon.Suddenly,hislifetakesaverydifferentturn. HighClassHomos like9.6M Comedy HighClassHomos Momozerii PrincessSapphiaofMytileneisnotintoprinces.So,whenherparentsstartputtingtheheatonhertogethitched,sheenliststhehelpofherequallygaybestfriend,PrinceAugustofPhthia.Butwillthesetworoyalsbeabletopulloffaconvincingshammarrie?Moreimportantly,willSapphiaeverlandadatewiththecastlemaids?Followthesehighclasshomosastheynigatelife,love,and(occasionally)theiractualjobs. TheGreatestEstateDeveloper like6.8M Fantasy TheGreatestEstateDeveloper Leehyunmin/KimHyunsoo WhencivilengineeringstudentSuhoKimfallsasleepreadingafantasynovel,hewakesupasacharacterinthebook!SuhoisnowinthebodyofLloydFrontera,alazynoblewholovestodrink,andwhosefamilyisinamountainofdebt.Usinghisengineeringknowledge,Suhodesignsinventionstoerttheterriblefuturethatliesinwaitforhim.Withthehelpofagianthamster,aknight,andtheworld’smic,canSuhodighisnewfamilyoutofdebtandbuildabetterfuture? BabyTyrant like1.5M Fantasy BabyTyrant LeeHuin/Awon GyeoulYoonisnostrangertotredy,hinglosteverything--evenherlife--becauseofhergood-for-nothingfather.Whenshereawakensafterdeath,Gyeoulfindsherselfinthebodyofanewbornbaby--sheisnowPrincessMabelofthepowerfulErmaneauEmpire!Withherdotingnewfamilyandtheempire’smightatherdisposal,Mabelhaseverythingshe’severwanted.Uponlearningthatshe’sthesubjectofaprophecywiththeworld’ssalvationatstake,Mabelquicklyrealizesthattherearepeoplewhowillstopatnothingtodestroyhernewfoundpeace. MythicItemObtained like2.3M Fantasy MythicItemObtained Jungseonyul/Hess Inaworldwheretechnologyandmicarealmostindistinguishablefromoneanother,monstersandcreaturesofmythandlegendreignterroruponmankind.Inhumanity’sdarkestmoment,individualswithspecialgod-likepowersemergetosetheday.Theyare—theAwakened.MeetJaehyeon,afeebleAwakenedhumanRaider,whostrugglestomakeendsmeetuntilonedayaseriesofconfoundingeventsallowhimtoclaimapowerfulitemthatwillchangethecourseofhistoryforever… MyLuckyStrike like1.1M Romance MyLuckyStrike bakSSdam Siruisdevastatedwhenhercrush,thedreamyGibaekSeol,effectivelyfriendzonesher.Shegoesoutthatnighttodrownhersorrows,butafteronetoomanydrinks,endsupaccidentallykissingsomeone.Thenextday,twopeopleinherclassshowupwithaswollenlip.OneisGibaek,andtheotherisCheong,atallandquietguywho’salwaysbeenabitofanenigmatoher.Injustoneday,Siru’snon-existentdatinglifetakesasharpturnandshesuddenlyfindsherselfwithtwoloveprospects.WillshefinallybeabletogetherhappyendingwithGibaek?OrstartsomethingnewwiththemysteriousCheong? Operation:TrueLove like12.7M HIATUS Romance Operation:TrueLove kkokkalee/Dledumb It’sharddatingsomeonewhowon’tgiveyouthetimeofday.Su-aeShimknowsthatbetterthananyone,hingdatedherindifferentboyfriend,MinuKang,foryears.Shesometimeswishesshecouldbemorelikehercharismaticstepsister,Ra-im,whoseemstoheitall.ButlifetakesaturnfortheweirdwhenSu-aediscoversJellypop,asentientflipphone,inherlocker.Jellypophasalottosayaboutherlovelife,especiallyasSu-aedriftsfurtherawayfromMinuandfindsherselfrunningintoMinu’sfriend,Eunhyeok.AddtothemixagrowingsuspicionthatMinuandRa-immightbemorethanfriends,andSu-aemightneedamiracletonigatetheupsanddownsofhighschoolromance! SuitorArmor like11.6M Fantasy SuitorArmor Purpah Lady-in-waiting,Luciabelievesgettingthroughtheroyalweddingwillbethetoughestpartofhernewlife.ThatisuntilshefindsherselffallingheadoverheelswithModeus,anup-and-comingknighttotheking'sguard.Withhernewfoundinterest,sheisquicklyawakenedtothemysteriesofthekingdomwhenshelearnsModeusisinfactanenchantedsuitofarmorwithoutasoul.Couldtherebemoretohimthanjustshiningarmor? TheeofArrogance like1M Fantasy TheeofArrogance SOYMEDIA/Hansol Afterwinningalongwar,AshaPervazisexpectingtheemperortocompensateherwithmoney.Unlikeherexpectationsthough,theemperorasksAshatochooseherownhusbandfromalistofnobles.AshachoosesDukeCarlisleHen,theemperor’seldestsonandformercrownprince.Ashaexpectshimtoobjectandpayanalimonyinstead,butthedukeactuallyreestomarryher!HeevenpromisestohelpAsharebuildPervaz.Whatdoesthedukereallywant?AndwillAshagetwhatshewantswithoutgettingembroiledinthegrowingroyalconspiracy? TheGuyUpstairs like4.4M HIATUS Thriller TheGuyUpstairs HanzaArt Rozyfindsherneighbor,theguywholivesupstairsalittlebittoosuspicious. VillainwithaCrush like3.5M Romance VillainwithaCrush seyoon Dumpedafterconfessingtoherfirstcrushofthreeyears,RosaParkfallsforhersecondwhenthenation’sforiteSuperpoweredPoliceOfficer,DoryeongHan,swoopsintoseherasshe’splummetingfromatopplingbuilding.Afewyearslater,amysteriousvillaincalledBlackdogappears,butDoryeongnoticessomethingisnotquiteright.Willtheworld’sworstvillaineverwintheheartofthestrongestherointhecountry? Nevermore like4.6M HIATUS Supernatural Nevermore KateFlynn/KitTrace Thereisnothingdefinitiveaboutlifeafterdeath,excepttheinvoluntaryenrollmentatthemysteriousNevermoreAcademy.NowLenoreandAnnabelLeemustbegintheircurriculumtorecoverthememoriesoftheirtricdemise.BetweentheDean'smacabredemeanorandthetell-taledangersofFinalExams,bothgirlsmustlearntorelyononeanotherandtheirnewlyacquiredghostforms,orSpectres,tonotonlygraduatefromtheacademy…buttoearnasecondchanceatlife. ILoveYoo like38.1M HIATUS Drama ILoveYoo Quimchee Doggedbypainandmisfortunefromtheverybeginning,Shin-Aedecidesshewantsnothingtodowithpeoplenoranythingtodowithromance.Althoughcontentwithherunsocial,boring,lovelessexistence,herlifestyleischallengedaftersheruinsanunsuspectingstrangers'clothes. BailinandLiYun like425,231 UP Romance BailinandLiYun Jayessart Dr.LiYunisdoingresearchinthearcticwhenhemeetsastrange,injuredcreaturenamedBailin.Discoveringamythicalspeciesmightbethedreamofeveryscientist,butwillBailinbeabittoomuchtohandle?Thearctichasneverfeltsowarm. WhoStoletheEmpress? AsEmpress,Roselynwasbelovedbyall…exceptherhusband,whoplotswithhismistresstooustthebeautifulandsaciousconsort.Nowshefindsherselflefttodiealoneintheicymountains,witheveryoneshelovesdeadorimprisoned.Justassheisabouttoacceptthistricfate,anoldadversaryfindsherandstealsheraway…Whatcouldthisrugged,younggeneralpossiblyheinstoreforthefallenEmpressofThanatos? like732,046 Romance WhoStoletheEmpress? Leejihye/Muhly AsEmpress,Roselynwasbelovedbyall…exceptherhusband,whoplotswithhismistresstooustthebeautifulandsaciousconsort.Nowshefindsherselflefttodiealoneintheicymountains,witheveryoneshelovesdeadorimprisoned.Justassheisabouttoacceptthistricfate,anoldadversaryfindsherandstealsheraway…Whatcouldthisrugged,younggeneralpossiblyheinstoreforthefallenEmpressofThanatos? IThoughtMyTimeWasUp! like3M Romance IThoughtMyTimeWasUp! Essie/Hyeyong Feelingalittleundertheweather,LarietteBlanchevisitsDoctorZakascoffonlytofindoutthatshehasanextremelyrarecongenitaldisease,andonlythreemonthslefttolive.Thoughdevastatedatfirst,Lariettedecidestowriteupabucketlistofeverythingshewantstodobeforeshedies.However,littledidsheknowthatthedinosiswasactuallywrong!Withsomanychangesimplementedinherlifealready,whatwillLariettedomovingforward?Willshereturntoherpreviouslife,orcontinuelivingthenewone,fullofadventuresshehadneveriminedbefore? TheKissBet like14.9M Romance TheKissBet IngridOchoa It’ssenioryearandSaraLinjustturned18.She’sgotgreatfriends,acoolDad(orsohethinks)andawholelotaheadofher.Thelastthingsheneedsistoworryabouthingherfirstkiss.Butthat’sallabouttochangebecausehergoodpalPatrickjustchallengedhertoabetthatwilleitherleadtolove,heartbreakorembarrassment…ormaybeallthree. ForMyDerelictForite Whathappensafterthestoryendswitha“happilyeverafter”?WhenHestiaentersherforitenovelasasidecharacter,shehappilyfangirlsfromthesidelines.Thinkingshe’llreturnhomewhenthestoryreachesitsend,Hestiafindsthattheonlythingawaitingheristhetricdeathofherforitecharacter.Nowmiraculouslyrestoredtothedayoftheending,Hestiadecidesthatshe’llnolongerspectatefromthesidelines–instead,she’llseherderelictforite! like4M Romance ForMyDerelictForite KimSeonyu/Ryuho Whathappensafterthestoryendswitha“happilyeverafter”?WhenHestiaentersherforitenovelasasidecharacter,shehappilyfangirlsfromthesidelines.Thinkingshe’llreturnhomewhenthestoryreachesitsend,Hestiafindsthattheonlythingawaitingheristhetricdeathofherforitecharacter.Nowmiraculouslyrestoredtothedayoftheending,Hestiadecidesthatshe’llnolonge(WEBTOON) Đọc truyện tranh trực tuyến.rspectatefromthesidelines–instead,she’llseherderelictforite! ASpellforaSmith like81,301 Fantasy ASpellforaSmith ArtSasquatch Ashywitchinherquietforestcotte.Asurlydwarfinhisblacksmith'sforge.Bothseekingsolaceintheirrespectiverefuge,butbothachingformore.Thoughdrawntoeachother'skindness,theycan'tdenythegentlechemistrysimmeringbeneaththeireveryinteraction...justastheirsecretsdo.Thisseriescontainsthemesregardinganxiety,mentalhealth,andself-harmthatmaynotbesuitableforallreaders.Viewerdiscretionisadvised.Ifyouorsomeoneyouknowisstrugglingorincrisis,pleasereachoutforhelpatCrisisTextLine(httpcrisistextline.org/). Swolemates like1.8M Comedy Swolemates LummyPix Whenthecocky,social-mediastarBraydin,andthenerdy,gamerAlexfirstmeetatthegym,theirrelationshipstartsoffonthewrongfoot.But,asthey'reforcedtoworktogethertheyfindouttheymighthemoreincommonthantheyinitiallythought.AlsotheygetbuffAF. ClinicofHorrors like7.4M Supernatural ClinicofHorrors Merryweather/PokuriMio Inastrangecity,thereisaclinicthatwilltreatthevictimsofhorrificdiseases.Foraprice. Daybreak like7.7M Sliceoflife Daybreak Moosopp Marcushasacrush,andCogiscompletelyunpreparedforthehijinksthatfollow.Hopefullyintheireffortstogrowcloser,theycanbrighteneachother'sday. DoomBreaker like5.3M Action DoomBreaker Blue-Deep Zephyristhelasthumanfightingevilinaworldabandonedbythegods.WhenheiskilledinbattlebyTartarus,thegodofdestruction,allhopeforhumanityseemslost.ButZephyr’sfateisnotsealed--thegodswhofindhisbattlesentertaininghegiftedhimasecondchanceatlife,asheissenttenyearsintothepast,backtowhenhewasasleinsteadofthemostpowerfulhumanalive.CanZephyrgethisrevengeainstTartarusandsethewomanheloves,orishedoomedtorepeatthepast? Bugtopia like458,002 Sliceoflife Bugtopia Idolomantises AspiderMomandherladybugson?Abeetlepowercouple?Abutterflypopstar?Awaspknightandabeeprincess?Inaworldsolargeforthesetinybugs,anythingispossible!Findoutwhoyou’llmeet,learnwhatsecretstheyallholdandenjoyyourstayinthislittlekingdomcalledBugtopia. LoreOlympus like68.9M Romance LoreOlympus RachelSmythe Witnesswhatthegodsdo…afterdark.Thefriendshipsandthelies,thegossipandthewildparties,andofcourse,forbiddenlove.Becauseitturnsout,thegodsaren’tsodifferentfromusafterall,especiallywhenitcomestotheirproblems.Stylishandimmersive,thisisoneofmythology’sgreateststories--TheTakingofPersephone--asit’sneverbeentoldbefore. TheRemarriedEmpress like34.1M Fantasy TheRemarriedEmpress Alphatart/Sumpul NierEllieTroviwasanempressperfectineveryway--intelligent,coureous,andsociallyadept.Shewaskindtohersubjectsanddevotedtoherhusband.NierwasperfectlycontenttolivetherestofherdaysasthewiseempressoftheEasternEmpire.Thatis,untilherhusbandbroughthomeamistressanddemandedadivorce.“Iacceptthisdivorce…AndIrequestanapprovalofmyremarrie.”Inashockingtwist,Nierremarriesanotheremperorandretainshertitleandchildhooddreamasempress.Butjusthowdideverythingunfold? MyIn-LawsareObsessedwithMe like9.3M Fantasy MyIn-LawsareObsessedwithMe seungu/HanYoonseol PereshatiJahardtisacount'sdaughterwhogotremarriedafterhermother’spassing.Whenherfatherdied,heleftherallhisfortune.Then,Pereshati'sgreedystepmotherandstepsisterconspirewithPereshati'slovertokillher.However,undermysteriouscircumstances,Pereshatiisbroughtbacktolifeandtrelsbackintimebeforehermurder.Tobuysometimebeforegettingherrevenge,Pereshativisitsthehandsomeyetnotoriousgrandduke,TherdeoLapileon,tomarryhim.Duringhervisit,sheuncoversahorrifyingsecretofhisfamily.HowwillPereshatidealwithit?Willshebeabletotakeherrevenge? CastleSwimmer like25.5M HIATUS Fantasy CastleSwimmer WendyLianMartin Whathappenswhenyourentirelifeisruledbyaprophecy–yourfutureforetoldbypeopleyou’venevermet,whodiedlongbeforeyouwereborn.Suchisthestoryoftwoyoungseacreatures.Onebelievedtobeaguidinglightforhispeople,aBeaconwhowillleadthemtoabright,prosperousfuture.Theotherisateeneprinceforwho’sdestinyistoKILLtheBeaconsothatHISownpeoplemightthrive.Whenbothrejectthecoursesetforthem,itleadstoaraucousadventureasbigandunpredictableastheoceanitself–andaromancethatnobodycouldhepredicted. HighClassHomos like9.6M Comedy HighClassHomos Momozerii PrincessSapphiaofMytileneisnotintoprinces.So,whenherparentsstartputtingtheheatonhertogethitched,sheenliststhehelpofherequallygaybestfriend,PrinceAugustofPhthia.Butwillthesetworoyalsbeabletopulloffaconvincingshammarrie?Moreimportantly,willSapphiaeverlandadatewiththecastlemaids?Followthesehighclasshomosastheynigatelife,love,and(occasionally)theiractualjobs. ObsidianBride like373,488 Romance ObsidianBride V0RA/Chungpurm Forallherlife,poorLuerihasbeenhangingbyathread,andthesituationdoesn'tgetanybetterwhensheisforcedintoanunwelcomemarrie.Butbymiracleordesign,amicalinvitationpresentsherwithawayofescapingherlovelesslife--byjoiningtheempire’sJewelBox.There,amongthebrilliantgemstones,shefindshelpintheunlikeliestofplaces,friendsfromtheunlikeliestofcrowds,andperhaps,somethingshe’sbeendesperatelyyearningforuntilnow--truelove. FromaKnighttoaLady like6.8M Fantasy (WEBTOON) Đọc truyện tranh trực tuyến. FromaKnighttoaLady Ink./HyerimSung EstellemeetsheruntimelydeathasavaliantknightoftheKingdomofErsha.ButdeathisnottheendforEstelle--threeyearsafterherdemise,shefindsherselfreincarnatedinthebodyofLucifelaAydin,thespoiledandcold-hearteddaughterofacountintheEmpireofJansgar.Toherdismay,shefindsthathercountryfelltoJansgaryearso,andthatsheisnowbetrothedtoZedekiahHeint,thesonofadukeandheradversaryinherpreviouslife.CanEstellediscoverthetruthbehindherdeathwhileattemptingtonigatehernewlifeasLucifela? BoundlessAscension Seong-yunHanwasjustaboywhenhisparentswerekilledbymonstersunleashedduringamysteriouscalamitycalledthe“DungeonBreak.”Sevenyearslater,Seong-yunisdevastatedtofindthathisgrindingeffortstobecomeaHunter,fiercewarriorswhoseekoutanddestroymonsters,areentirelyinvain,ashisfightingattributeshenotincreasedatall.Seong-yun’sworldflipsonadimewhenheacceptsaninvitationtojointheTowerofTrials,anotherworldlyrealmwherechallengersmustovercometrialsthatpitthemainstmonstersandhumansalike. like1.1M Action BoundlessAscension 2love(REDICESTUDIO)/SHYATAN(REDICESTUDIO) Seong-yunHanwasjustaboywhenhisparentswerekilledbymonstersunleashedduringamysteriouscalamitycalledthe“DungeonBreak.”Sevenyearslater,Seong-yunisdevastatedtofindthathisgrindingeffortstobecomeaHunter,fiercewarriorswhoseekoutanddestroymonsters,areentirelyinvain,ashisfightingattributeshenotincreasedatall.Seong-yun’sworldflipsonadimewhenheacceptsaninvitationtojointheTowerofTrials,anotherworldlyrealmwherechallengersmustovercometrialsthatpitthemainstmonstersandhumansalike. PerfectMarrieRevenge like7.1M Romance PerfectMarrieRevenge Yibambe/soyoung IjuHanisn’tsurewhereherlifewentwrong.Oncetheheiresstoawealthybusinessmnate,she’snowanordinaryhousewifewhosemainconcernsareherngingin-lawsandhouseholdchores.Thingstakeamuchmoretricturn,however,whenshefindsherhusbandconfessinghislovetoherstepsister.Devastated,sherunsaway,onlytobehitbyacarandkilled.Butwhensheopenshereyes,shefindsthatshe’sawakenedayearointhepast,beforeherlifewentawry.Givenasecondchanceatlife,Ijuvowsrevenge,determinedtotakebackallthatshe’slost. NewtoWEBTOON Spore like36,610 NEWUP Thriller Spore Leekang Oneday,anunidentifiedflyingobjectappearsintheskyalongwithunknowninsect-likemonsters.Anormalhighschoolstudent,SeunghoYun,istryingtosurviveaswellasfindhisfamily.Alongtheway,heisaidedbyamessethattellshimthefuturethatonlyappearsinhishead.Ashemovesonwiththatslightadvante,hefindsoutthatthereareotherswhoaregettingthesamemesseashim.Willhebeabletofindhisfamily?Andwherearethemessesinhisheadcomingfrom? TraceKeeper like20,015 NEW Supernatural TraceKeeper KAYRAA Whenanaccidentkillsoverfortypeopleinasmallminingtown,twohighschoolstudentsventureintoanunderworldfilledwithinnumerablewondersinordertoexposeadeepconspiracyattheheartofacreepingcorruption;anexplorationonlivingwithgrief,hand-in-handwithdeath. ZombieRevelation:82-08 like17,703 NEW Action ZombieRevelation:82-08 Dalah/Kyungwoo AmysteriousvirusbreaksoutonboardtheBoat82-08outatsea.Thepeoplewhofindoutaboutitfirstonlywanttouseitasaweaponbutquicklylosecontroloverthevirus.WilltheTriosurvivelongenoughtorejointheirfriendJinu?OrwillitbeJinuwhodoesn’tmakeitouttomeethisfriends? ParanoidMe Callumhasseenstrangethingsallhislife-monsters,beasts,andmessecretlylivingamongpeople.Butevenafterawakeninghisportalmic,Callumhasnodesiretobeanypartofit.TheGuildofArcaneRegulationdemandsfealty,education,andserviceofeverynewme.Tohellwiththat.IftheywantCallum,they'llhetocatchhimfirst. like8,079 NEWUP Action ParanoidMe InadvisablyCompelled/KisaiEntertainment Callumhasseenstrangethingsallhislife-monsters,beasts,andmessecretlylivingamongpeople.Butevenafterawakeninghisportalmic,Callumhasnodesiretobeanypartofit.TheGuildofArcaneRegulationdemandsfealty,education,andserviceofeverynewme.Tohellwiththat.IftheywantCallum,they'llhetocatchhimfirst. TheDevil’sKiss like79,443 NEWEND Romance TheDevil’sKiss KwakDabin/ParkNahyeon Onthebrinkofdeath,EunjiisapproachedbyahandsomedevilnamedJoshua,whopromisesherasecondshotatlifewithakisstosealthedeal.WhenEunjiwakesuptoher“second”life,nothingseemsdifferentuntilDojin,thehumanmanifestationofJoshua,showsupatherschoolandstartsfollowinghereverywhereshegoes,turningheadsandcausingdrama.Theirhoneymoonperiodiscutshortwhenyetanotherdevil,Sora,comestoruintheirfun.CanJoshuasehisfirstlovefromtheforcesofEarthandhell? God'sGambit like42,891 NEWUP Action God'sGambit 2HD/Bsamong Dogodsplaydicewiththefateofentirecities?YulChoi’scityissuddenlytransportedtobecomeapieceinaboardgameofthegods.JustwhenYulthinkshecanworktogetherwithpeopletoovercomethemonstersandchallenges,herealizeshemustbecomethecity’sgreatestvillaintosethecity.CanYulrisetothedemandingtaskofbecomingthegreatestandmostvillainousherohiscityhaseverseen? ASpellforaSmith like81,261 NEW Fantasy ASpellforaSmith ArtSasquatch Ashywitchinherquietforestcotte.Asurlydwarfinhisblacksmith'sforge.Bothseekingsolaceintheirrespectiverefuge,butbothachingformore.Thoughdrawntoeachother'skindness,theycan'tdenythegentlechemistrysimmeringbeneaththeireveryinteraction...justastheirsecretsdo.Thisseriescontainsthemesregardinganxiety,mentalhealth,andself-harmthatmaynotbesuitableforallreaders.Viewerdiscretionisadvised.Ifyouorsomeoneyouknowisstrugglingorincrisis,pleasereachoutforhelpatCrisisTextLine(httpcrisistextline.org/). TheSeductiveWife Thisseriescontainsthemesregardingdomesticabuse,sexualcontentandthemesthatmaynotbesuitableforallreaders.Viewerdiscretionisadvised.Somemarryforlove,andsomemarryforconvenience.InIjae’scase,shemarriesYuheon,thesonofabusinesstycoon,toseherfamilyafterherfatherendsupindeepdebt.Eventhoughtheirmarrieiscontractual,IjaefeelsanintenseattractionforthecoldandcalculatingYuheon.Everynightinherdreams,sheimineswhatitwouldbeliketomakelovewithhim…untiloneday,thetwoendupactuallysharingapassionatenighttogether.Butwilltheirphysicalchemistrybeenoughtobuildagenuineconnection?OrwillIjaeremainapawninYuheon’sgame? like94,692 NEW Drama TheSeductiveWife YoonSoda/RedpeachStudio Thisseriescontainsthemesregardingdomesticabuse,sexualcontentandthemesthatmaynotbesuitableforallreaders.Viewerdiscretionisadvised.Somemarryforlove,andsomemarryforconvenience.InIjae’scase,shemarriesYuheon,thesonofabusinesstycoon,toseherfamilyafterherfatherendsupindeepdebt.Eventhoughtheirmarrieiscontractual,IjaefeelsanintenseattractionforthecoldandcalculatingYuheon.Everynightinherdreams,sheimineswhatitwouldbeliketomakelovewithhim…untiloneday,thetwoendupactuallysharingapassionatenighttogether.Butwilltheirphysicalchemistrybeenoughtobuildagenuineconnection?OrwillIjaeremainapawninYuheon’sgame? prev next GENRES New&Trending > 1 Fantasy ASpellforaSmith ArtSasquatch 2 Fantasy TheRebornYoungLordisanAssassin SWINGBAT/CoffeeLime 3 Drama TheSeductiveWife YoonSoda/RedpeachStudio 4 Action Steel-EatingPlayer Director9/JJJ 5 Action NightoftheGoblin munsik/dool Noailableseriesyet.Pleasecheckbacklater. ORIGINALSbyGenre > SUPERNATURAL (selected) ALL ACTION ROMANCE FANTASY DRAMA COMEDY THRILLER SLICEOFLIFE SUPERNATURAL (selected) SCI-FI HORROR Others 1 Supernatural ClinicofHorrors Merryweather/PokuriMio 2 Supernatural TheLastBloodline weyowang/WmW 3 Supernatural I'mtheGrimReaper GREWEER 4 Supernatural DarkWater Punkcoa 5 Supernatural Persona3Reload:Beginnings MerryweatherMedia Noailableseriesyet.Pleasecheckbacklater. WEBTOONCANVAS Heastorytotell?ShareitonWEBTOONCANVAS. Findeverythingyouneedtogetitpublished. Findoutmore Catnip OsakaAmaru TheWitchandtheSeaSlug Sparo.art DetectivesforHire SmidgeonPigeon. TheDreamEater narriose GardenofTales lorphis Phantomarine ClaireK.Niebergall HungryHeart bildosola José&Miguel ShoiZino IntheAbsenceofSnowdrops FoxyJoy TheStinkyBossCat 巧西Chelsealy WEBTOON DownloadWEBTOONnow! GETITonGooglePlay DownloadontheAppStore facebook instram twitter youtube About | Feedback | Help | Terms | Privacy | PersonalData | Advertise | DoNotSellorShareMyPersonalInformation | Contact | English 中文(繁體) ภาษาไทย Indonesia Español Français Deutsch ⓒNERWEBTOONLtd. WEBTOON window.defaultErrorMesse={ 'alert.error.no_internet_connection':'NoInternetConnection.\nPleasecheckthenetworkconnection.', 'alert.error.invalid_input':'Invalidinputvalue.', 'alert.error.unknown':'Unknownerrorhasoccurred.Pleasetryaininamoment.'};window.__commonScriptState__={ contentLangue:'ENGLISH', contentLangueCode:"en", browserType:"CHROME", countryCode:"CN", isNotNoticePe:true, domain:'', recentBarParam:{ imgDomain:'webtoon-phinf.pstatic.net', langue:'en', title:'Recentlyviewed', domain:'', contentLangue:'en' }, noticeParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ "menu.notice":"Notice" } }, loginOptions:{ isAuthorPublishLogin:false, authorPublishDescLinkUrl:"/en/creators101/webtoon-canvas", ailableSnsList:["GOOGLE","APPLE","FACEBOOK","LINE","TWITTER"], nclkLangueCode:"en_en", messes:{ "login.default.component.default.title":'Loginnowandenjoyfreecomics', "login.default.component.default.desc":'Startreadingthousandsoffreecomicswithotherfansandcreators!', "login.default.component.email.button":'ContinuewithEmail', "login.default.component.sns.button.GOOGLE":'ContinuewithGoogle', "login.default.component.sns.button.APPLE":'ContinuewithApple', "login.default.component.sns.button.FACEBOOK":'ContinuewithFacebook', "login.default.component.sns.button.LINE":'ContinuewithLINE', "login.default.component.sns.button.TWITTER":'ContinuewithX', "alert.error.invalid_input":'Invalidinputvalue.', "alert.error.unknown":'Unknownerrorhasoccurred.Pleasetryaininamoment.', }, emailLoginOptions:{ captchaKey:"", emailLoginUrl:"/member/login/doLoginById", messes:{ "alert.error.unknown":'Unknownerrorhasoccurred.Pleasetryaininamoment.', "button.login":'LogIn', "menu.back":'Back', "login.email.component.title":'EmailLogin', "login.email.component.email_input.label":'EMAILADDRESS', "login.email.component.email_input.placeholder":'EnterEmailAddress', "login.email.component.email_input.warn.please_check":'Pleasecheckyouremailaddress ain.', "login.email.component.password_input.label":'PASSWORD', "login.email.component.password_input.placeholder":'EnterPassword', "login.email.component.password_input.button.show_password":'showpassword', "login.email.component.password_input.warn.please_check":'Pleasecheckyourpasswordain.', "login.email.component.password_input.warn.incorrect_multiple_times":'Youheenteredanincorrectpasswordover5times.', "login.email.component.password_input.warn.max_length":'Passwordscanbeupto16characters.', "login.email.component.captcha_input.placeholder":'Enterwhatappearsabove', "login.email.component.captcha_input.button.reload":'captchareload', "login.email.component.messe.influent.sign_up":'Don\'theanaccount?', "messe.login.forget_password":'ForgotPassword?', "button.signup":'SignUp', }, }, }, gdprCookieBannerMesses:{ 'gdpr.cookie_reement_banner.desc':'WEBTOONusescookiesnecessaryforauthenticationandsecuritypurposes.Wewouldalsoliketouseoptionalcookiestoprovidepersonalizedcontentandtoimproveourservicesbasedonhowyouusesuchservices.Youcanacceptorrefusealloptionalcookiesbyclickingontherelevantbuttonsbeloworyoucanmanetheuseofoptionalcookiesbyclickingonthe\'CookieSettings\'button.Formoreinformationoncookies,pleasereadour\u003Cahref=\":\/\/\/en\/terms\/cookiePolicy\"target=\"_blank\"\u003ECookiePolicy\u003C\/a\u003E.', 'gdpr.cookie_reement_banner.ree':'Iree.', 'gdpr.cookie_reement_banner.cookie_setting':'CookieSettings' }, ccpaCookieBannerMesses:{ 'ccpa.cookie_reement_banner.desc':'IreethatWEBTOONmayprocessmypersonalinformationinaccordancewiththeWEBTOON\u003Cahref=\":\/\/\/en\/terms\/privacyPolicy\"target=\"_blank\"\u003EPrivacyPolicy\u003C\/a\u003EandthatmypersonalinformationmaybedisclosedtotrustedthirdpartiesofWEBTOONforadvertisingandmarketingpurposes.IconfirmthatIamauthorizedtoprovidethisconsent.Theuseofdatacanbemanedinthe\u003Cahref=\":\/\/\/en\/cookieSetting\"\u003ECookieSettings\u003C\/a\u003Eand\/oratthelinkbelow.\u003Cbr\u003E', 'ccpa.cookie_reement_banner.desc.do_not_sell':'DoNotSellorShareMyPersonalInformation', 'ccpa.cookie_reement_banner.title':'ConsenttoThirdPartyAdvertisingandMarketing', 'ccpa.cookie_reement_banner.confirm':'Confirm', }, gdprChildProtectionPopupMesses:{ 'gdpr.child_protection_popup.challenge.header':'CANVASisunailabletochildrenundertheeof16residinginGermany.', 'gdpr.child_protection_popup.challenge.desc':'InordertocomplywiththeGermanYouthProtectionLaw,theuseofCANVAShasbeenrestricted.Pleaserefertoour\u003Cahref=\":\/\/help2.line.me\/LINE_WEBTOON\/pc?contentId=&lang=en\"target=\"_blank\"\u003EHelp\u003C\/a\u003Esectionformoreinformation.', 'button.ok':'OK' }, policyreePopupParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ 'policy.popup.title':'Greetingsfrom\u003Cbr\u003ENERWEBTOONLtd.', 'policy.popup.text':'Tofullyenjoyourservice,youmustreetothenewandupdatedTermsofUseandPrivacyPolicy.', 'policy.popup.desc':'Ireetothe{tou}and{pp}ofWEBTOON.', 'policy.popup.desc.tou':'TermsofUse', 'policy.popup.desc.pp':'PrivacyPolicy', 'policy.popup.caution':'Checkabovetoproceed.', 'policy.popup.submit':'Submit', 'policy.popup.cancel':'Cancel', 'policy.popup.cancel.continue':'Continuewithoutloggingin', 'policy.popup.text_for_gdpr':'Tofullyenjoyourservice,youmustreetothenewandupdatedTermsofUse.', 'policy.popup.desc_for_gdpr':'Ireetothe{tou}ofWEBTOON.', 'policy.popup.desc_for_gdpr_privacy':'Pleaseseeournewandupdated{pp}.', } }} window.__gnbState__={ locale:'en' ,gnbLayerId:'#header' ,messe:{ logoutMesse:'Areyousureyouwanttologout?' ,systemErrorMesse:'Unknownerrorhasoccurred.Pleasetryaininamoment.' } ,searchParam:{ locale:'en', messe:{ 'confirm.search.delete_history':'Areyousureyouwanttodeleteyourrecentsearchhistory?', 'messe.search.clear':'ClearRecentSearches', 'messe.search.autocomplete.webtoon':'WEBTOON', 'messe.search.autocomplete.artist':'Creator', 'messe.search.autocomplete.view_all':'ViewAll', 'messe.search.autocomplete.close':'Close' }, imgDomain:'webtoon-phinf.pstatic.net', templateParam:{ nclkLangueCode:"en_en", imeDomain:"webtoon-phinf.pstatic.net", messes:{ 'confirm.search.delete_history':'Areyousureyouwanttodeleteyourrecentsearchhistory?', 'messe.search.clear':'ClearRecentSearches', 'messe.search.autocomplete.webtoon':'WEBTOON', 'messe.search.autocomplete.artist':'Creator', 'messe.search.autocomplete.view_all':'ViewAll', 'messe.search.autocomplete.close':'Close' } } }, myLayerParam:{ domain:"", nclkLangueCode:"en_en", contentLangueCode:"en", communityProfileUrl:"", isailableCoinShop:false, supportsAuthorCommunity:true, messes:{ 'menu.forite':'Subscribed', 'menu.dashboard':'Dashboard', 'menu.mycomment':'Comments', 'menu.creator':'Creators', 'menu.mypost':'MyProfilePe', 'menu.account':'Account', 'menu.ads':'AdSharing', 'menu.coin.shop':'CoinShop', 'button.logout':'LogOut' } }, langueCode:'en', childProtectorParams:{ messes:{ "main":"Thisfeatureisunailable.Pleasereferto\u003Cbr\u003Ethe{childpp}formoreinformation.", "childpp":"Children’sPrivacyPolicy", "ok":"Close", }, childppLink:"/en/terms/childrensPrivacyPolicy" }, signUpLayerParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", messes:{ "messe.signup.desc":"IreetoWEBTOON\'s\u003Cahref=\":\/\/\/en\/terms?noLogin=true\"target=\"_blank\"className=\"N=a:log.termsofuse,g:en_en\"\u003E\n\t\tTermsofUse\n\t\u003C\/a\u003Eand\u003Cahref=\":\/\/\/en\/terms\/privacyPolicy?noLogin=true\"target=\"_blank\"className=\"N=a:log.privacy,g:en_en\"\u003E\n\t\tPrivacyPolicy\n\t\u003C\/a\u003E.", 'messe.signup.need_ree':'Clickthecheckbuttonbeforesubmitting.', 'button.sign_up':'Submit' } }, }; window.__rankingState__={ contentLangueCode:"en", rankingCount:5, rankingTemplateParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", imgQuality:"q90", imeDomain:"webtoon-phinf.pstatic.net" }, genreNameMap:{ 'ACTION':'Action', 'COMEDY':'Comedy', 'DRAMA':'Drama', 'FANTASY':'Fantasy', 'HEARTWARMING':'Heartwarming', 'HISTORICAL':'Historical', 'HORROR':'Horror', 'MYSTERY':'Mystery', 'ROMANCE':'Romance', 'SF':'Sci-fi', 'SLICE_OF_LIFE':'Sliceoflife', 'SPORTS':'Sports', 'SUPERNATURAL':'Supernatural', 'SUPER_HERO':'Superhero', 'THRILLER':'Thriller', 'TIPTOON':'Informative' }, challengeRankingGenreNameMap:{ }, rankingComponentInfoList:[ { "rankingComponentType":"WEBTOON_NEW_TITLE_RANKING", "queryParamKey":"", "titleListMaxSize":"5" }, { "rankingComponentType":"WEBTOON_GENRE_RANKING", "queryParamKey":"rankingGenre", "titleListMaxSize":"5" }, ], isPopularTabComponent:true, } window.__emailVerificationResultState__={ contentLangueCode:"en", messes:{ fail:{ "unknown":"Unknownerrorhasoccurred.Pleasetryaininamoment.", "expire":"Theverificationlinkhasexpired.Pleasetryaintoheanewverificationemailsent.", }, changeEmail:{ "content":"Thankyou.\u003Cbr\u003EYouremailhasbeenverified.", }, join:{ "title":"WelcometoWEBTOON!", "content":"Youremailhasbeenverified.You\'rereadytostartenjoyinghundredsoffreecomics!", "button":"Getstarted!", }, "okButton":"OK" }, }varghtGenreList={ ACTION:{ sName:'Action', sIntoduction:'Click,Scroll,andAction.', sSeoCode:'action', nCount:0 }, COMEDY:{ sName:'Comedy', sIntoduction:'Goodlaughterisallweneed.', sSeoCode:'comedy', nCount:0 }, DRAMA:{ sName:'Drama', sIntoduction:'Yourdailystripofdrama.', sSeoCode:'drama', nCount:0 }, FANTASY:{ sName:'Fantasy', sIntoduction:'Immerse,Imine,andInspire.', sSeoCode:'fantasy', nCount:0 }, HEARTWARMING:{ sName:'Heartwarming', sIntoduction:'Warmblankiesforyoursoul.', sSeoCode:'heartwarming', nCount:0 }, HISTORICAL:{ sName:'Historical', sIntoduction:'Openthedoortotrelthroughtimeandspace.', sSeoCode:'historical', nCount:0 }, HORROR:{ sName:'Horror', sIntoduction:'Doyoulovebeingscared?', sSeoCode:'horror', nCount:0 }, MYSTERY:{ sName:'Mystery', sIntoduction:'Uncoverthecrime!', sSeoCode:'mystery', nCount:0 }, ROMANCE:{ sName:'Romance', sIntoduction:'Beauty,romance,love:Thingswelivefor.', sSeoCode:'romance', nCount:0 }, SF:{ sName:'Sci-fi', sIntoduction:'Exploretheworldofscienceandinnovations.', sSeoCode:'sf', nCount:0 }, SLICE_OF_LIFE:{ sName:'Sliceoflife', sIntoduction:'Relateandsmile.', sSeoCode:'slice-of-life', nCount:0 }, SPORTS:{ sName:'Sports', sIntoduction:'Feelthepumped-upenergy.', sSeoCode:'sports', nCount:0 }, SUPERNATURAL:{ sName:'Supernatural', sIntoduction:'Witches,werewolves,andcryptids.Ohmy!', sSeoCode:'supernatural', nCount:0 }, SUPER_HERO:{ sName:'Superhero', sIntoduction:'Comesetheworldwithme.', sSeoCode:'super-hero', nCount:0 }, THRILLER:{ sName:'Thriller', sIntoduction:'Chill,Shiver,andShudder', sSeoCode:'thriller', nCount:0 }, TIPTOON:{ sName:'Informative', sIntoduction:'Tipsthatmaybringyouabetterlife!', sSeoCode:'tiptoon', nCount:0 } }window.__homeState__={ adParam:{ adOptions:{"slotId":"//PC_Main_Leaderboard_970x90_ime","adDivId":"div-gpt-ad-5","adPlatform":"GLAD","bidder":{"pubmatic":{"publisherId":"","adSlot":"Main_Mid_Desktop"},"triplelift":{"inventoryCode":"Webtoon_ROS_HDX_Prebid","floor":"0.15"},"rubicon":{"accountId":"","siteId":"","zoneId":""},"openx":{"unit":"7","delDomain":"linewebtoon-d.openx.net"}}}, targetings:{ langue:"en" ,productName:"linewebtoon" ,contentId:"common" }, sdkUrl:"ssl.pstatic.net/tveta/libs/glad/prod/gfp-core.js" }, homeParam:{ nclkLangueCode:"en_en", likeitSmallMesse:"Like", langueCode:"en", genreList:ghtGenreList, foriteGenreTemplateParam:{ domain:"", contentLangueCode:"en", nclkLangueCode:"en_en", imeDomain:"webtoon-phinf.pstatic.net" } }, eventWinnerPopupParam:{ templateParam:{ messes:{ 'messe.event_winner_popup.name':'Name', 'messe.event_winner_popup.email':'EmailAddress', 'messe.event_winner_popup.phone_number':'Phone', 'messe.event_winner_popup.address':'Address', 'messe.event_winner_popup.name.placeholder':'Entername', 'messe.event_winner_popup.email.placeholder':'aaa@bbb.com', 'messe.event_winner_popup.phone_number.placeholder':'Enterphonenumber', 'messe.event_winner_popup.address.placeholder':'Enteraddress', 'messe.event_winner_popup.name.warning':'Pleaseenteryourname.', 'messe.event_winner_popup.email.warning':'Pleaseenteryouremailaddress.', 'messe.event_winner_popup.phone_number.warning':'Pleaseenteryourphonenumber.', 'messe.event_winner_popup.address.warning':'Pleaseenteryouraddress.', 'messe.event_winner_popup.check_terms.1':'IreetoWEBTOON\'s', 'messe.event_winner_popup.check_terms.2':'.', 'messe.event_winner_popup.check_fees':'IreethatIamresponsibleforalltaxes,fees,andsurchargesonprizes.', 'messe.event_winner_popup.check_fees.warning':'Pleasecheckabovetoproceed.', 'messe.event_winner_popup.check_terms.privacy_policy':'PrivacyPolicy', 'messe.event_winner_popup.submit':'Submit', 'messe.event_winner_popup.refuse':'Irefusetoprovidemyinformation.', 'messe.event_winner_popup.refuse.confirm':'Don\'twishtoprovideyourinformationtoreceivethegiveaway?Ifyourefusenow,thisinformationpewillnotbeshownain.', }, domain:"", contentLangueCode:"en" } }}

Địa điểm:(WEBTOON) Đọc truyện tranh trực tuyến.Báo cáo

Nếu có vi phạm trang web, vui lòng nhấp vào Báo cáoBáo cáo

Thông tin đề xuất

Trang web được đề xuất